SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013763 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013763
Domain Number 1 Region: 26-203
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.05e-60
Family MHC antigen-recognition domain 0.0000000135
Further Details:      
 
Domain Number 2 Region: 207-296
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family C1 set domains (antibody constant domain-like) 0.00000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013763   Gene: ENSNLEG00000011327   Transcript: ENSNLET00000014441
Sequence length 298
Comment pep:known_by_projection supercontig:Nleu1.0:GL397427.1:2069338:2081385:-1 gene:ENSNLEG00000011327 transcript:ENSNLET00000014441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRMVSVLLSLLLLLSPAVPQETQDGRYSLTYIYTGLSKPIEDVPAFQALGLLNDLQFFS
YNSRDRKSQPVGLWRQVEGMEDWKQDSQLQKAREDIFMETLNNIMEYYNDSNGSHILQGR
FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQNTKQKWEAKPVYVQQAKA
YLEEGCPETLRKYLKYSKNILDRQDPPSVVVTSYQGPGEKKKLKCLAYDFYPGKIDMHWT
RAGEVQEPELQGNVLHDRNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAR
Download sequence
Identical sequences G1RKL1
ENSNLEP00000013763 XP_003278121.1.23891 ENSNLEP00000013763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]