SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013766 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013766
Domain Number 1 Region: 258-346
Classification Level Classification E-value
Superfamily DEATH domain 0.0000524
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013766   Gene: ENSNLEG00000011322   Transcript: ENSNLET00000014444
Sequence length 355
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:1166973:1170645:-1 gene:ENSNLEG00000011322 transcript:ENSNLET00000014444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRCLLTALLLLALEPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENC
GLNDHGDFVTPPFRECSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAK
GHCPLTPGNPGAPSFQERSSPASSIAWRTPEPVPQQALPNFLPLLVLVLLLTLAVTAILL
FILLWHLCRPKEKADPYPYPGLVCGVPNTHTPSSSHLSSPGALETGDTWKEASLLPLLSR
ELPSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAY
SLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA
Download sequence
Identical sequences G1RKK9
ENSNLEP00000013766 XP_003280100.1.23891 ENSNLEP00000013766 ENSNLEP00000024220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]