SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013768 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013768
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.94e-56
Family MHC antigen-recognition domain 0.0000000978
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-22
Family C1 set domains (antibody constant domain-like) 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013768   Gene: ENSNLEG00000011330   Transcript: ENSNLET00000014446
Sequence length 297
Comment pep:novel supercontig:Nleu1.0:GL397427.1:2086007:2093322:1 gene:ENSNLEG00000011330 transcript:ENSNLET00000014446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRMVSVLLSLLLLLSPAVPQETQDGHYSLTYLYTGLSRPGKDTTGCRALSSNDRAFFHY
NSEDRKAEPLGPWKHVEGVEDWEKQSQVQKAREDIFMETLNNIMEYYNDSNESHTLQERF
GCEIHNNRSTGAFWKNAYNGKDYIEFNKEIPAWVPLVPEAQNTKQKWEAEPVYAQRAKAY
LEEECPATLQKYLKYSKNILDQQDLPSVVVTSHQAPGENRTLKCLAYDFYPGKIDMHWTQ
AGKVQDPELWGDVLHGGNGTYLTWLLVHVPPQDTAPYSCHVQHSSLAQPLVVPWEAR
Download sequence
Identical sequences ENSNLEP00000013768 ENSNLEP00000013768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]