SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013792 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013792
Domain Number 1 Region: 44-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-17
Family Splicing factor U2AF subunits 0.0000117
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000013792
Domain Number - Region: 151-173
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000565
Family CCCH zinc finger 0.0061
Further Details:      
 
Domain Number - Region: 21-38
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0131
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013792   Gene: ENSNLEG00000011333   Transcript: ENSNLET00000014470
Sequence length 220
Comment pep:novel supercontig:Nleu1.0:GL397480.1:1170724:1173623:-1 gene:ENSNLEG00000011333 transcript:ENSNLET00000014470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLASIFGTEKDKVNRSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQ
TADGSQCHVSDVEVQEHYDSFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRRE
EDAERAVAELSNRWFNGQAVHAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISQN
LRRQLYGWGPRRRSPPRFHTGHRPRERNRRHSSDHQHGRF
Download sequence
Identical sequences A0A2I3GF42
ENSNLEP00000013792 ENSNLEP00000013792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]