SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013846 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013846
Domain Number 1 Region: 185-279
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000665
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Domain Number 2 Region: 26-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000643
Family I set domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013846   Gene: ENSNLEG00000011325   Transcript: ENSNLET00000014528
Sequence length 557
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:121594:129661:1 gene:ENSNLEG00000011325 transcript:ENSNLET00000014528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPCLLFFLLFLTPMEVRPQERLVVKVEEGDNAVLQCLKGTSDGPTQQLTWCRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSHQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSRKLMNPQLYVWAKDRPKVWEGEAPCGPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKWPKSSLLSLELKDDRPARDM
WVMETDLLLPRATAQDAGTYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAY
LIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTS
GLGRAQRWAAGLGGTAASYGNPSSDVQADGAVGSRSPPGVGPEEEEGEGYEEPDSEEGSE
FYENDSNRGQEQLSQDGSGYENPEDEPLGPEDEDSFSSAESYENEDEELTQPVARTMDFL
SPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDG
PDPAWGGGGRIGTWSTR
Download sequence
Identical sequences ENSNLEP00000013846 XP_003261486.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]