SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013897 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013897
Domain Number 1 Region: 94-420
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.97e-68
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000000247
Further Details:      
 
Domain Number 2 Region: 424-552
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.49e-39
Family Ricin B-like 0.00000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013897   Gene: ENSNLEG00000011400   Transcript: ENSNLET00000014579
Sequence length 571
Comment pep:known_by_projection supercontig:Nleu1.0:GL397370.1:4872735:5621044:1 gene:ENSNLEG00000011400 transcript:ENSNLET00000014579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDL
CLDVSRLNGPVIMLKCHHMRGNQLWEYDAETHTLLHIITQSCLSVNKVADGSQHPTVETC
NDSTLQKWLLRNYTRMEIFRNIFGNSTDYIL
Download sequence
Identical sequences A0A2K6CZP2
ENSNLEP00000013897 XP_007963177.1.81039 XP_007963178.1.81039 XP_009441787.2.37143 XP_011508839.1.92137 XP_011759061.1.29376 XP_011759062.1.29376 XP_016805321.1.37143 XP_016858747.1.92137 XP_016858748.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]