SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013955 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013955
Domain Number 1 Region: 185-291
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-37
Family Link domain 0.0034
Further Details:      
 
Domain Number 2 Region: 296-381
Classification Level Classification E-value
Superfamily C-type lectin-like 4.98e-30
Family Link domain 0.0011
Further Details:      
 
Domain Number 3 Region: 71-183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000644
Family V set domains (antibody variable domain-like) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013955   Gene: ENSNLEG00000011475   Transcript: ENSNLET00000014639
Sequence length 381
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:6213904:6225729:-1 gene:ENSNLEG00000011475 transcript:ENSNLET00000014639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKDRRWTCLPWPGSPWHEEMGLLLLVPLLLLPGSYGLPFYNGFYYSNSANDQNPGNGH
GKDLLNGVKLVVETPDETLFTYQGASVILPCRYRYEPALVSPRRVRIKWWKLSENGAPEK
DVLVAIGLRHRSFGDYQGRVHLRQDKEHDVSLEIQDLRLQDYGRYRCEVIDGLEDESGLV
ELELRGVVFPYQSPNGRYQLNFHQGQQVCAEQSAVVASFEQLFRAWEEGLDWCNAGWLQD
ATVQYPIMLPRQPCGGPGLAPGVRSYGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTL
TEAREACQEDDATIAKVGQLFAAWKFHGLDRCDAGWLADGSVRYPVVHPHPNCGPPEPGV
RSFGFPDPQSRLYGVYCYRQH
Download sequence
Identical sequences ENSNLEP00000013955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]