SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000013962 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000013962
Domain Number 1 Region: 239-340
Classification Level Classification E-value
Superfamily Immunoglobulin 2.3e-18
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 936-1024
Classification Level Classification E-value
Superfamily Fibronectin type III 3.14e-18
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 856-943
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 641-741
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000303
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 339-440
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000807
Family C1 set domains (antibody constant domain-like) 0.024
Further Details:      
 
Domain Number 6 Region: 134-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000155
Family C1 set domains (antibody constant domain-like) 0.039
Further Details:      
 
Domain Number 7 Region: 34-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000281
Family I set domains 0.053
Further Details:      
 
Domain Number 8 Region: 735-837
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000299
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 444-547
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000038
Family I set domains 0.0067
Further Details:      
 
Domain Number 10 Region: 544-645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000066
Family V set domains (antibody variable domain-like) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000013962   Gene: ENSNLEG00000011461   Transcript: ENSNLET00000014647
Sequence length 1240
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:1259092:1284803:-1 gene:ENSNLEG00000011461 transcript:ENSNLET00000014647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGTTLRASLLLLGLLTEGLAQLVIPASVPRGFWALPENLTVVEGASVELRCGVSTPGS
AVQWAKDGLLLGPDPRIPGFPWYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSETGP
ELVSPRVILSILVPPKLLQLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTI
SDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPP
GPPVIEWPGLDEGHVRAGQSLELPCVAQGGNPLATLQWLKNGQPVSTAWGTEHTQAVARS
VLVMTVRPEDHGVQLSCEAHNSVSAGTQERSITLQVTFPPSAITILGSASQTENKNVTLS
CVSKSSRPRVLLRWWLGWRQLLPMEETVMDGLYGGHISMSNLTFLARREDNGLTVTCEAF
SEAFTKDTFKKSLTLNVKYPAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYK
VGATPGDSRPVTESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFTCKAGQLSASTQLA
VQFPPTNVTILANASSLRPGDFLNLTCVSVSSNPLLAALAPRVHRLEGVAAPPRRAPFKG
SAAARSVLLQVSSRDHGQRVTCRAHSAELRETVSSFYRLNVLYRPEFLGEQVLVVTVVEQ
GEALLPVSVSANPAPEGFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRADDGLYQLHC
QNSEGTAEALLRLDVHYAPTIRALQDPTEVNVGGSVDIVCTVDANPILPGMFSWERLGED
EEDQSLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLVRLVVRFAPQVE
HPTPLTKVPAAGDSTSSATLHCRARGVPNIVFTWTKNGVPVDLQDPRYTEHTYHQGGVHS
SLLTIANVSATQDYALFTCTATNALGSDQTNIQLVSISRPDPPSGLKVVSLTPHSVGLEW
KPGFDGGLPQKFCIRYEALGTPGFHYVDVLPLQATTFTLTGLQPSTRYRIWLLASNALGD
SGLADKGTQLPITTPGGKGGLGRLEFTEGYLPPLGPSGLPLLPVLFALGGLLLLSNASCV
GGVLWQRRLRRLAEGISEKTEAGWKEDRVRNEYEESQWTGERDTRSSHVSTTEAEPYKRS
LRDFSPQLPPTQEEVSYSRGLTGEDEDMVFPQHLYDEVERTYPPSGAWGPLYDEVQMGPW
DLRWPEDTYQDPTGIYDQVAGDLDTLEPDSLPFELRGHLV
Download sequence
Identical sequences ENSNLEP00000013962 ENSNLEP00000013962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]