SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014004 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014004
Domain Number 1 Region: 140-303
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.63e-47
Family CRAL/TRIO domain 0.0000787
Further Details:      
 
Domain Number 2 Region: 45-131
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.49e-16
Family CRAL/TRIO N-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014004   Gene: ENSNLEG00000011513   Transcript: ENSNLET00000014691
Sequence length 317
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:6547296:6559857:-1 gene:ENSNLEG00000011513 transcript:ENSNLET00000014691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETRE
EAVRELQEMVQAQAASGEELAVAVAERVQEKDNGFFLRFIRARKFNVGRAYELLRGYVNF
RLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAY
CFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHF
IHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKA
VAEQLFGPRAQAENTAF
Download sequence
Identical sequences G1RL97
ENSNLEP00000014004 ENSNLEP00000014004 XP_003268533.1.23891 XP_012362795.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]