SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014009 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014009
Domain Number 1 Region: 120-226
Classification Level Classification E-value
Superfamily Fibronectin type III 3.01e-32
Family Fibronectin type III 0.000000526
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 7.03e-31
Family C2 set domains 0.00000496
Further Details:      
 
Domain Number 3 Region: 434-618
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-19
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 4 Region: 228-328
Classification Level Classification E-value
Superfamily Fibronectin type III 3.82e-17
Family Fibronectin type III 0.00000114
Further Details:      
 
Domain Number 5 Region: 346-424
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000513
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014009   Gene: ENSNLEG00000011482   Transcript: ENSNLET00000014696
Sequence length 863
Comment pep:known_by_projection supercontig:Nleu1.0:GL397355.1:1366357:1381134:-1 gene:ENSNLEG00000011482 transcript:ENSNLET00000014696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLGTCSLTWAALIILLLPRSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESTITLPHFNHTQAFLSCCLNWGNSLQILDRVELRAG
YPPAVPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDAILDCVPK
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPVLRTMDPSPE
AAPPEAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALRYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPIVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSCPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPQGYVIEWGLGPPSVSNSNKTWRME
ENGSATGFLLKENIRPFQLYEITVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPTSLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHILLGLFGLLLLLACLSGTAWLCCSPNRKNLLWP
SVPDPAHSSLSSWVPTIMEELPGPRQGRWLGQTSEMSRALTLHPCVQDAFQLPGLGTPRI
TKLTVLEEDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAASTQPQSQSGTSDQVLYG
QLLGSPTSPGPGHYLRCDSTQPLLAGLTPSPKSYENLWFQASPLRTLVTPAPSQEDDCVF
GPLLDFPLLQGIRVHGMEGLGSF
Download sequence
Identical sequences ENSNLEP00000014009 ENSNLEP00000014009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]