SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014031 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014031
Domain Number 1 Region: 367-458
Classification Level Classification E-value
Superfamily Immunoglobulin 3.84e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 79-183
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 3 Region: 179-283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000105
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 280-364
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000305
Family I set domains 0.039
Further Details:      
 
Domain Number 5 Region: 453-556
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000034
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014031   Gene: ENSNLEG00000011490   Transcript: ENSNLET00000014720
Sequence length 764
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:1289858:1299391:1 gene:ENSNLEG00000011490 transcript:ENSNLET00000014720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLGGLQAKDTGSLGWGEESSVKGAPGQGDRRRACEEEVDGKARATANLVNLGGQTLRM
RVPALLVLLFCFRGSAGPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSGLALG
GQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVAPE
APQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVRLDGTTFHQTLLKEGTPGS
VENTLTLTPFSHDDGATLVCRARSQALPAGRDTAITLSLQYPPEVTLSASPHTVQEGEKV
IFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFLTEPVSCEVSNAVGSANRST
ALDVLFGPILQAKPEPVSVDVGEDASFSCAWRGNPLPRVTWTRRGGAQVLGSGATLRLPS
VRPEDAGDYVCRAEPGLSGLGGGAAEARLTVNAPPVVTALHSAPAFLRGPARLQCLVFAS
PAPDAVVWSWDEGFLEVGSQGRFLVETFPAPESRGGQNPGLISVLHISGTQESDFSRSFN
CSARNRLGEGGARASLGRRDLLPTVRIVAGVAAATTTLLMVITGVALCCWRHSKASASFS
EQKNLMRIPGSSDGSSSRGPEEEETGSREERGPVVHTDHSDLVLEEEGTLDTRDPTNGYY
KVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRAGAGYLTT
PHPRAFTSYIKPTSFGPPDLAPGTPHFPYAAFHTPSHPRLQTHV
Download sequence
Identical sequences A0A2I3GHI9
ENSNLEP00000014031 ENSNLEP00000014031 XP_004089244.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]