SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014036 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014036
Domain Number 1 Region: 490-793
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.96e-102
Family PDEase 0.000000602
Further Details:      
 
Domain Number 2 Region: 276-467
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 119-268
Classification Level Classification E-value
Superfamily GAF domain-like 1.59e-19
Family GAF domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014036   Gene: ENSNLEG00000011508   Transcript: ENSNLET00000014725
Sequence length 808
Comment pep:known_by_projection supercontig:Nleu1.0:GL397340.1:7905119:8256778:-1 gene:ENSNLEG00000011508 transcript:ENSNLET00000014725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGASFALAAAAALLFGSDMEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDE
FVSESVSAETVEKWLRGRQQIRTPDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGD
NQLLLYELSSIIKIATKADGFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTV
SAYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWG
KEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLL
EHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIA
GQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGS
AFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMQ
FTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRR
VPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHP
LAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGN
RKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGD
EMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQ
WEKVIRGEETATWISSPSVAQKAAASED
Download sequence
Identical sequences ENSNLEP00000014036 ENSNLEP00000014036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]