SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014067 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014067
Domain Number 1 Region: 3811-4005
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-36
Family Laminin G-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 3325-3436
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 3219-3323
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-30
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 2267-2378
Classification Level Classification E-value
Superfamily Cadherin-like 7.98e-28
Family Cadherin 0.00082
Further Details:      
 
Domain Number 6 Region: 2799-2907
Classification Level Classification E-value
Superfamily Cadherin-like 9.95e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 921-1024
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 3115-3218
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-27
Family Cadherin 0.00051
Further Details:      
 
Domain Number 9 Region: 3013-3121
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-26
Family Cadherin 0.00081
Further Details:      
 
Domain Number 10 Region: 1554-1655
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 816-919
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-26
Family Cadherin 0.00094
Further Details:      
 
Domain Number 12 Region: 1031-1132
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-25
Family Cadherin 0.00075
Further Details:      
 
Domain Number 13 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 14 Region: 2065-2172
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.003
Further Details:      
 
Domain Number 15 Region: 2908-3019
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 16 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 17 Region: 3429-3533
Classification Level Classification E-value
Superfamily Cadherin-like 7e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 18 Region: 1448-1552
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 19 Region: 2172-2279
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 457-558
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-21
Family Cadherin 0.001
Further Details:      
 
Domain Number 21 Region: 1787-1875
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-21
Family Cadherin 0.0053
Further Details:      
 
Domain Number 22 Region: 2379-2479
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-21
Family Cadherin 0.0029
Further Details:      
 
Domain Number 23 Region: 2482-2592
Classification Level Classification E-value
Superfamily Cadherin-like 5e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 24 Region: 2580-2690
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-19
Family Cadherin 0.001
Further Details:      
 
Domain Number 25 Region: 1660-1760
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 1233-1362
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-18
Family Cadherin 0.0033
Further Details:      
 
Domain Number 27 Region: 1868-1966
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-16
Family Cadherin 0.0035
Further Details:      
 
Domain Number 28 Region: 562-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000694
Family Cadherin 0.0036
Further Details:      
 
Domain Number 29 Region: 1974-2077
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000002
Family Cadherin 0.0017
Further Details:      
 
Domain Number 30 Region: 2696-2805
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000357
Family Cadherin 0.0042
Further Details:      
 
Domain Number 31 Region: 3538-3627
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000004
Family Cadherin 0.0087
Further Details:      
 
Domain Number 32 Region: 4035-4163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000534
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 33 Region: 367-452
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000614
Family Cadherin 0.004
Further Details:      
 
Domain Number 34 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000671
Family Cadherin 0.0077
Further Details:      
 
Domain Number 35 Region: 4010-4047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000671
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014067
Domain Number - Region: 273-352
Classification Level Classification E-value
Superfamily Cadherin-like 0.000557
Family Cadherin 0.0071
Further Details:      
 
Domain Number - Region: 3790-3821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0568
Family Laminin-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014067   Gene: ENSNLEG00000011574   Transcript: ENSNLET00000014759
Sequence length 4584
Comment pep:known_by_projection supercontig:Nleu1.0:GL397338.1:7830859:7956745:-1 gene:ENSNLEG00000011574 transcript:ENSNLET00000014759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRHLALLLLLLLLFQHFGDSDGSQRLEQTPLQFTHLEYNVTVHENSAAKTYVGHPVKMG
IYITQPSWEVRYKIVSGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KALEKNTNVEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAVDRGMKLYGSSGISSM
AKLTAHVEQANECAPVITAVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLL
QQFRTVRSFPGSKEYKVKAIGGVDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
KAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPGYSHLRYVFKSTLGKAKFSLNYNTGLI
SILEPVKRQQAAHFELEVTTSDRKVSTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGT
TVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVQYQIEAGNELDLFSLNPNSGVLSLKQSLMDGLAAKMSFHSLRITATDGENFATPLYIN
ITVAASRKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTL
PTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAISGGNEDSCFMIDMETGMLKILSPL
DRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSE
IIQVEATDKDLGPNGHVTYSILTDTDTFSIDSVTGVVKIARPLDRELQHEHYLKIEARDQ
AREEPQLFSTVILKVSLEDVNDNPPKFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSG
QVRYSLMDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEV
EVVDVNENLHPPVFSSFVEKGTVKEDVPIGSLVMTVSAHDEDAGRDGEIRYSIRDGSGVG
VFRIGEETGVIETSDRLDHESTSHYWLTVFATDQGVVPLSSFMEIYIEVGDVNDNAPQTS
EPVYYPEIMENSPKDVSVVQIEAFDPDSSSSDKLMYKITSGNPQGFFSIHPKTGLITTTS
RKLDREQQDEHILEVTVTDSGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
DRDRNAKREPLYRVIATDKDDGPNAEISYSIEDGNEHGKFFIEPKTGVVSSRRFSAAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPKPSPEPISFEESFFTFTVMESDPVAHMIGVI
SVEPPGIPLWFDITGKHSPSFSLSVWVTLRRICIRVSYKNEERSSLSYSYLDNHFVIRQV
FIKVIDTNDHRPQFSTSKYEVVIPEDTAPETEILQISAVDQDEKNKLIYTLQSSRDPLSL
KKFRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWF
TASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSFVIDPVLGSIKTA
KELDRSNQVEYDLMVKATDKGSPPMSEITSVRIFITIADNASPKFTSKEYSVEISETVSI
GSFVGMVTAHSQSSVVYEIKDGNIGDAFDINPHSGTIITQKALDFETLPIYTLIIQGTNM
AGLSTNTTVLVHLQDENDNFFFMQAEYTGLIESASINSVVLTDRNVPLVIRATDADKDSN
ALLVYHIVEPSVHKYFAIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAAN
VTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFAQLIYSITEGNIG
DKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFAGLTSVKINVKESKESHLKFTQDVY
SAVVKENSTEAKTLAVITAIGNPINEPLFYHILNPDRRFKISRTSGVLSTTGIPFDREQQ
EAFDVVVEVTEERKPSAVAHVVVKVIVEDRNDNAPVFVNLPYYAIVKVDTEVGHVIRYVT
AVDRDSGRNGEVHYYLKEHHEHFQIGPLGEISLKKQFELDTLNKEYLVAVVAKDGGNPAF
SAEVIVPITVMNKAMPVFEKPFYSAEIAENIQVHSPVVHVQANSPEGLKVFYSITDGDPF
SQFTINFNTGVINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVEDINDNPPVFA
QQSYAATLSEASVIGTSVVQVRATDSDSEPNRGISYHMFGNLSKSHDHFHVDSNTGLISL
LRTLDYEQSRQHTIFVRAVDGGMPPLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAP
HGHFVTCVKAYDADSSDADKLQYSILSGNDHKHFVIDSATGIITLSNLRRHALKPFYSLN
LSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDRDSGIY
GHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDDGGKVAFCTVNV
ILTDDNDNAPQFRATKYEVNIGSSAAKGTSVIKVLASDADEGSNADVTYAIEADSESVKE
NLEINKLSGVVTTKESLIGLENEFFTFFVRAADNGSPSKESVVPVYVKILPPEMQLPKFS
EPFYTYTVSEDVPIGTEIDLIRAEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEK
SLDHETTKWYQFSILARCTQDDHEVVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPG
GSRVIQIRASDADSGTNSQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQ
IKVVASDHGEKIHLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAILSTTD
ADSEEINRQVTYFITGGDPLGQFAVENIQNEWKVYVKKPLDREKRDNYLLTITATDGTFS
SKAIVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITYTLLG
SGAEKFKLNPDTGELRTSTPLDREEQAVYHLLVRATDGGGRFCQASVVLTLEDVNDSAPE
FSADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQFSINELSGIIQLE
KPLDRELQAVYTLSLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGATVSEDIL
VGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLT
VEATDGGTPSLSDVATVNINVTDINDNTPVFSQDTYTAVISEDAVLEQSVITVMADDADG
PSNSHIHYSIIDGNQGSSFTIDPIRGEVKVTKLLDRETISGYTLTVQASDNGSPPRVNTT
TVNIDVSDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGN
DEKAFEVNQQGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYVDIRVIEESIYPPA
ILPLEIFITASGEEYSGGVIGKIHATDQDVYDTLTYSLDPQMDNLFSVSSTGGKLIAHKK
LDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLNHTIAVRFANLTPEEFVGDYWRNFQ
RALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKSGSAQISTKQLLHKINSSVTDIEE
IIGVRILNVFQKLCAGLDCPWRFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKE
GKCPPVHHGCEDNPCPEGSECVSDPREEKHTCVCPGGRFGQCPGSSSMTLTGNSYVKYRL
TENENKLEMKLTMRLRTYSMHAVVMYARGTDYSILEIHHGRLQYKFDCGSGPGIVSVQSI
QVNDGRWHAVSLEVNGNYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIRQQGTRHG
RSPQVGNGFRGCMDSIYLNGQELPLNSKPRSYAHIEESVDVSPGCFLTAAEDCASNPCQN
GGVCSPSPAGGYYCKCSALYIGTHCEISVNPCSSNPCLYGGTCVVDSGGFVCQCRGLYTG
QRCQLSPYCRDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDVDECTGNPCLHGALCEN
THGSYHCNCSHEYRGRHCEDAAPNQYVSTPWNIGLAEGIGIVVFIAGIFLLVVVFVLCRK
MISRKKKHQAEPEDKHLGPATAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDS
RNNLDRNSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQ
KPSWDFDYDTKVVDLDPCLSKKPLEEKASQPYSARESLSEVQSLSSFQSESCDDNGYHWD
TSDWMPSVPLPDIQEFPNYEVIDEQTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPA
ADELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMSEPQTK
GTGENRTCRESHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVSACCEVESEVMMSDY
ESGDDGHFEEVTIPPLDSQQHTEV
Download sequence
Identical sequences ENSNLEP00000014067 ENSNLEP00000014067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]