SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014114 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014114
Domain Number 1 Region: 41-299
Classification Level Classification E-value
Superfamily L domain-like 1.26e-44
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 2 Region: 294-389
Classification Level Classification E-value
Superfamily Immunoglobulin 7.77e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 424-501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000934
Family Fibronectin type III 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014114   Gene: ENSNLEG00000011612   Transcript: ENSNLET00000014807
Sequence length 627
Comment pep:known_by_projection supercontig:Nleu1.0:GL397480.1:1368209:1373870:1 gene:ENSNLEG00000011612 transcript:ENSNLET00000014807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILPLLLCLLPLAPASSPPQSATPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR
AAELRLADNFIASVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLT
SLGEGQLRGLVNLRHLILSNNQLAALAASALDDCAETLEDLDLSYNNLEQLPWEALGRLG
NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS
ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
RSPPLAVPAGRPAALRCRAVGDPEPHVRWVSPQGRLLGNSSRARAFPNGTLELLVTKPGD
GGIFTCIAANAAGEATAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKV
ADTGPPTDRGVQVTEHGATAALVQWPDQRPXXXXXXXXXXXDLTPTCLPCRMIPADSRSF
LLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFSTEPALRPCGAPHAPFLGGTMII
ALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKTPAPVSSVCSQTNGALGPTPTPAPPAP
EPAALRAHTVVQLDCEPWGPGHEPVGP
Download sequence
Identical sequences ENSNLEP00000014114 ENSNLEP00000014114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]