SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014149 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014149
Domain Number 1 Region: 134-198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000135
Family Complement control module/SCR domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014149   Gene: ENSNLEG00000011627   Transcript: ENSNLET00000014842
Sequence length 370
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:4391522:4426149:-1 gene:ENSNLEG00000011627 transcript:ENSNLET00000014842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIFSGSKAAAAFGEVAELAPAGGGAPAGLSSARAGARVPAPRRHLRGHSPRPAAHNRAQG
PGGRPGKSQAEQLEATSAGRGQVDPSRREGWRESALRWLCPLSPQWGHRTECTLEVPEHK
ERGGPGGSRACVGITCPPPTSVEHADIRVKSYSLYSRERYVCNSGFKRKAGTSSLTECVL
NKATNVAHWTTPSLKCIRDPALARQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSPN
TTAATTAAIVPGSRLMPSKSPSTGTTEIGSHESSHGTPSQTTAKTWELTASASHQPPGVY
PQGHSDTTVAISTSTVLLCGLSAMSFLACYIKSRQTPLPASVEMEAMEALPVTGGTSSRD
EALENCSHDL
Download sequence
Identical sequences ENSNLEP00000014149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]