SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014165 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014165
Domain Number 1 Region: 35-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.12e-68
Family Ephrin receptor ligand binding domain 0.00000217
Further Details:      
 
Domain Number 2 Region: 634-930
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-66
Family Protein kinases, catalytic subunit 0.0000000447
Further Details:      
 
Domain Number 3 Region: 337-534
Classification Level Classification E-value
Superfamily Fibronectin type III 4.46e-26
Family Fibronectin type III 0.00045
Further Details:      
 
Domain Number 4 Region: 932-1003
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.19e-16
Family SAM (sterile alpha motif) domain 0.00089
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014165
Domain Number - Region: 266-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000449
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014165   Gene: ENSNLEG00000011640   Transcript: ENSNLET00000014858
Sequence length 1008
Comment pep:known_by_projection supercontig:Nleu1.0:GL397355.1:2591418:2634226:-1 gene:ENSNLEG00000011640 transcript:ENSNLET00000014858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGAGPHPLRLFLCRMPLCLALLLGPWRPGTAEEVILLDSKASHAELGWTALPSNGWEE
ISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAG
TCKETFNVYYLETEADLGRGRPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREI
GPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLATFPATAAESAFSTLVEVAGTC
VAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDICEACPPGFYKVSPRRPLCS
PCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWL
PPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFVPRQAGLRERAATLLHLRPGAR
YTVRVAALNGVSGPAAAAGTTYAQVTVSTGPGAPWEDDEIRRDRVEPQSVSLSWREPIPA
GAPGANDTEYEIRYYEKGQSEQTYSMVKTGVPTVTVTNLKPATRYVFQIRAASPGPSWEA
QSFNPSIEVQTLGEAASGSRDQSPAVVVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGG
DARDEEELYFHFKVPTRRTFLDPQSCGDPLQAVHLFAKELDAKSITLERSLGAGRFGELC
CGCLQLPGRQELPVAVHTLRDSASDSQRLGFLAEALTLGQFDHSHIVRLEGVVTRGSALM
IVTEYMSHGALDGFLRRHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRGLAARRVLVSS
DLVCKISGFGRGPRDRSEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGIIMWEVM
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPNPLHRLMLDCWQKDPGERPRFSQIHSIL
SKMVQDPEPPKCAPTTCPRPPTPLADRAFSTFPSFGSVGAWLEALDLCRYKDSFTAAGYG
SLEAVAEMTAQDLVSLGISSAEHREALLSGISALQARVLQLQGQGVQV
Download sequence
Identical sequences A0A2I3GM05
ENSNLEP00000014165 ENSNLEP00000014165 XP_003273339.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]