SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014170 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014170
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000121
Family Complement control module/SCR domain 0.000016
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000181
Family Complement control module/SCR domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014170   Gene: ENSNLEG00000011642   Transcript: ENSNLET00000014863
Sequence length 272
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:4462985:4516083:-1 gene:ENSNLEG00000011642 transcript:ENSNLET00000014863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIAHATFKAVAYKEGTMLNCECKRGFRRIKS
GSPYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEERKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGETETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEVAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQKKSRRTI
Download sequence
Identical sequences G1RLR0
ENSNLEP00000014170 XP_003257660.1.23891 ENSNLEP00000014170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]