SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014175 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014175
Domain Number 1 Region: 116-226
Classification Level Classification E-value
Superfamily Fibronectin type III 7.81e-18
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 21-130
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000236
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014175   Gene: ENSNLEG00000011639   Transcript: ENSNLET00000014868
Sequence length 538
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:1167850:1220976:-1 gene:ENSNLEG00000011639 transcript:ENSNLET00000014868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKG
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFVPLYKDCSGDFKKWVGAPFTGSS
LELGSWSPEVPSTLEVYSCHPPQSAAKRLQLTELQEPAELVESDGVPKPSFWPTVQSLGG
SAYSEERDRPYGLVSIDTVTVRDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLG
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PPAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Download sequence
Identical sequences G1RLR5
ENSNLEP00000014175 ENSNLEP00000023500 XP_003261598.1.23891 XP_003261600.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]