SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014186 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014186
Domain Number 1 Region: 2208-2445
Classification Level Classification E-value
Superfamily Plakin repeat 2.09e-84
Family Plakin repeat 0.000000000503
Further Details:      
 
Domain Number 2 Region: 1966-2201
Classification Level Classification E-value
Superfamily Plakin repeat 4.01e-76
Family Plakin repeat 0.00000232
Further Details:      
 
Domain Number 3 Region: 2519-2559,2608-2802
Classification Level Classification E-value
Superfamily Plakin repeat 5.14e-68
Family Plakin repeat 0.00000000787
Further Details:      
 
Domain Number 4 Region: 836-964,991-1018
Classification Level Classification E-value
Superfamily Spectrin repeat 5.38e-16
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 5 Region: 326-455
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000108
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 6 Region: 2458-2512
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000602
Family Plakin repeat 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014186
Domain Number - Region: 189-239
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00117
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014186   Gene: ENSNLEG00000011664   Transcript: ENSNLET00000014879
Sequence length 2869
Comment pep:known_by_projection supercontig:Nleu1.0:GL397343.1:7536000:7585921:1 gene:ENSNLEG00000011664 transcript:ENSNLET00000014879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCNGGSHPRINTLGRMTRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTG
TMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEI
LDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRSIHNSIGDYRWQLDKIKA
DLVLFCVSFSLQTFELPVQKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
RNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKE
LEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGD
ECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYTKTIADLELHYQEFIRNSQGSEMF
GDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRE
NDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIA
EVLNQLKDMLASFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQT
EDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHS
QTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCK
WLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHNEISGKRDKSEEVQKIAELCANSIKD
YELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEM
LKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLE
ELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYD
QLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGARKREYENELAKVRNHYN
EEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSI
LQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTI
QDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQL
TMQKEEDTSGYRAEIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDVQQQKATGSEV
SQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCL
EDENARLQRVQYDLQKANSSATETINKLKVEQELTRLRIDYERVSQERTVKDQDITRFXX
XXXXXXXXXXXXXXXXXXLKRTASEDSCKRKKLEELEGMRRSLKEQAIKITNLTQQLEQA
SIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRN
EHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEAD
SDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESK
NQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKATLEAETRVKQRLECEKQQIQN
DLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTR
ETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYE
CQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISP
ESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYTAEKAITGFDDPFSG
KTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSL
NDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTEL
VDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGL
VRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDP
ETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELS
EILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLR
KRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDR
KTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNAVGTSSSMGGGVSDDVF
SSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIV
DSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVK
GKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQ
RLQDTSTYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSA
PGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH
Download sequence
Identical sequences ENSNLEP00000014186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]