SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014247 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014247
Domain Number 1 Region: 33-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000867
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014247   Gene: ENSNLEG00000011714   Transcript: ENSNLET00000014948
Sequence length 303
Comment pep:known_by_projection supercontig:Nleu1.0:GL397427.1:2373246:2402347:1 gene:ENSNLEG00000011714 transcript:ENSNLET00000014948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQPLLLPLLLPLLLPPAFLQPGGSAGSSPSLPYGVTQPKRLSAPMGGSVEIPFSFYYPW
ELATAPNMKISWRRGHFHGQFFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRILSLRKED
QSVYFCRVELDTLRSGRQQWQSIEGTKLSITQALTTTTNPLSRPPPWRLSSTTTTAGLRV
TQGKRRSDSWHISLETAMGVAVAVAVLGITILGLICLLRWRRRKGKCPGPALSPSREPFQ
NTEEPYENIRNEGQNTDPKLNPKDDGIIYASLALSSSTSPIAPPSRHPLKSPRNDTLYSV
LKA
Download sequence
Identical sequences ENSNLEP00000014247 ENSNLEP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]