SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014262 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014262
Domain Number 1 Region: 508-708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-22
Family SPRY domain 0.0081
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.66e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 431-511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000104
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000783
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014262
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0339
Family ZZ domain 0.04
Further Details:      
 
Domain Number - Region: 251-341
Classification Level Classification E-value
Superfamily Prefoldin 0.0602
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014262   Gene: ENSNLEG00000011724   Transcript: ENSNLET00000014967
Sequence length 727
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:13941295:13998559:-1 gene:ENSNLEG00000011724 transcript:ENSNLET00000014967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESGEMSEFGYIMELLAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKEL
LLTLDDSFNDVGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTIFPCPGCEH
DVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGN
HANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEDAI
THFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQIQMEEYQGLLENSGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKISRDDEMSWNEIEVCGTSKIIQDLEN
SSAYAFRVRAYKGSVCSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESR
AGFNLLLAAERIQVGYYTSLDYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEW
LRSPRDAVSPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPSSNEPENRVLP
MPTSIGIFLDYDKGKVNFYDMDQMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITAKY
LEYQEDM
Download sequence
Identical sequences G1RLZ8
ENSNLEP00000014262 ENSNLEP00000014262 XP_003259894.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]