SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014272 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014272
Domain Number 1 Region: 614-914
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-84
Family Protein kinases, catalytic subunit 0.00000000105
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-73
Family Ephrin receptor ligand binding domain 0.000000941
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 7.71e-40
Family Fibronectin type III 0.0000769
Further Details:      
 
Domain Number 4 Region: 908-978
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000224
Family SAM (sterile alpha motif) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 253-317,363-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000852
Family Growth factor receptor domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014272   Gene: ENSNLEG00000011707   Transcript: ENSNLET00000014977
Sequence length 983
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:941841:1325125:-1 gene:ENSNLEG00000011707 transcript:ENSNLET00000014977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHLSILLLLSCSVLNCFGEVIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNDRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFHTTGDWLNGVRTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKTGPVPV
Download sequence
Identical sequences G1RM08
ENSNLEP00000014272 XP_003255175.1.23891 ENSNLEP00000014272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]