SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014309 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014309
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.96e-16
Family Supernatant protein factor (SPF), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 182-314
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000798
Family Toll/Interleukin receptor TIR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014309   Gene: ENSNLEG00000011774   Transcript: ENSNLET00000015016
Sequence length 340
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:14409689:14446863:-1 gene:ENSNLEG00000011774 transcript:ENSNLET00000015016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVY
FDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLN
TRVAYWHSVDTSPGYHESDSKKSEDLSLYNVADHSNTTEGPAGKQEGAQSVEEMLEEAEE
EVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWT
ILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFVLQTINAL
EEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
Download sequence
Identical sequences ENSNLEP00000014309 ENSNLEP00000014309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]