SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014366 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014366
Domain Number 1 Region: 225-320
Classification Level Classification E-value
Superfamily Immunoglobulin 4.37e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 126-227
Classification Level Classification E-value
Superfamily Immunoglobulin 3.54e-16
Family C1 set domains (antibody constant domain-like) 0.062
Further Details:      
 
Domain Number 3 Region: 32-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000129
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014366   Gene: ENSNLEG00000011796   Transcript: ENSNLET00000015078
Sequence length 437
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:4349712:4690064:-1 gene:ENSNLEG00000011796 transcript:ENSNLET00000015078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVLFLCNLYLVPAAASKNKVKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSN
PAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYL
TVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDAN
RKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFP
QEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEA
TNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNA
LAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAII
NAEGSQVNAEEKKEYFI
Download sequence
Identical sequences A0A2I3GAN6
ENSNLEP00000014366 XP_003255189.1.23891 ENSNLEP00000014366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]