SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014379 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014379
Domain Number 1 Region: 2768-3031
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-69
Family Protein kinases, catalytic subunit 0.0000024
Further Details:      
 
Domain Number 2 Region: 1936-2132
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-54
Family DBL homology domain (DH-domain) 0.0000131
Further Details:      
 
Domain Number 3 Region: 1274-1452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 4 Region: 2134-2256
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-32
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 5 Region: 1459-1573
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-25
Family Pleckstrin-homology domain (PH domain) 0.00000195
Further Details:      
 
Domain Number 6 Region: 2661-2757
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 7 Region: 291-427
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1088-1225
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 838-991
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 512-653
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2526-2590
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000969
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1623-1713
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000332
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 47-201
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 658-765
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000948
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 205-321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000497
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014379
Domain Number - Region: 432-544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014379   Gene: ENSNLEG00000011777   Transcript: ENSNLET00000015091
Sequence length 3075
Comment pep:known_by_projection supercontig:Nleu1.0:GL397290.1:13321714:13690857:1 gene:ENSNLEG00000011777 transcript:ENSNLET00000015091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALVYTSVKRGSHGTHCPGSGDGGRAEAQRAGRRGFRKNDEMKAMDVLPILKEKVAYLSG
GRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMRGSKWDSI
KPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQL
TPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIE
EHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRL
HSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAM
ELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIRQIASQLEQEWKAFAAALD
ERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQDLEDAIHHHQGIYEHITLAY
SEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHR
KVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQ
NTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHT
HVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQL
RDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDI
ISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNE
VQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQ
VLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQAN
HYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREE
DWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGM
VTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNG
EFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIK
KCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQLDIIPASIPGSEVKLRDA
AHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKEL
IIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLIL
EHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVML
SVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVF
SKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKVRSFEA
GNENLESVREAAQEPLRDPRKEVIGAPPSICSTAFGGKRVGGALDKQEGHGTPNTGSLWG
RVAGTHLEESPALSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTT
DRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSVSSNDASPPASVASLQPHMIGAQ
SSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDS
AATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLL
QPDSQDDKASSRLLVRPTSSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPS
FNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVETERDYVRDLGCVVEGYMALMKE
DGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVY
CQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKPVQRIMKYQLLLKDFLKYSKKA
SLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDAGLLP
RCRERRIFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFALTSR
TGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNALTSPIEYQRNHSGGGGGSGGSG
GGGGSGGGGAPSGGSGHSGGPSSCGGAPSTSRSRPSRIPQPVRHHPPVLVSSAASSQAEA
DKMSGTSTPGPSLPPPGAAPEAGPSAPSRRPPGADAEGSEREAEPIPKMKVLESPRKCAA
NASGPSPDASTKDARASLGTLPLGKPRPGAASPLNSPLSSAVPSPLGKEPFPPSSPLQKG
GSFWSSIPASPASRPGSFTFPGDSDSLQRQTPRHAAPGKDTDRMSTCSSASEQSVQSTQS
NGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAA
EGWIPGFVLGHTSAVIMENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKS
REGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPE
HNTLNNDGHYSISYSDLGEATLKIVGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGMD
GIMVTWKDNFDSFYSEVAELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELG
ILQSLQHPLLVGLLDTFETPTSYILVLEMADQGRLLDCVVRWGSLTEGKIRAHLGEVLEA
VRYLHNCRIAHLDLKPENILVDESLAKPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPE
IILGNPVSLTSDTWSVGVLTYVLLSGVSPFLDDSVEETCLNICRLDFSFPDDYFKGVSQK
AKEFVCFLLQEDPAKRPSAALALQEQWLQVGNGRSTGVLDTSRLTSFIERRKHQNDVRPI
RSIKNFLQSRLLPRV
Download sequence
Identical sequences ENSNLEP00000014379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]