SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014390 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014390
Domain Number 1 Region: 1-113,203-464
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.41e-53
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014390   Gene: ENSNLEG00000011834   Transcript: ENSNLET00000015104
Sequence length 993
Comment pep:known_by_projection supercontig:Nleu1.0:GL397438.1:1391109:1597500:1 gene:ENSNLEG00000011834 transcript:ENSNLET00000015104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQ
KQPIPFFVETLIFHPKEEDKVLAYTKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVD
ADPDLVHVEAQDLGGDFRYVTCPIHNCSEKMLTAPFTGPIDHGSLTVQEDYIFFKATSAN
RTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGV
RYALVLQDVRSSRQAEESVLIDILEVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRP
PSMDMNGRPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKE
EMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFT
STSVFVDGLLSEPGDETLVMTVFGHISFRSDWELVKVDFRPSFSRQCGEEDYSSWDLSNL
QGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSPSSESNT
NKCSANFWFNPLSPPDNCALGQTYTSSLGYRKVVSNVCEGGVDLQQSQVQLQCPLTPPRG
LQVSIQGEAVAVRPGEDVLFVVRQEQGIAISQPVQTTGGSRGLETRFLTVNNARDMEENR
VGCRGYQGPRRAEGDVGKVTGFGIKCIHSPPLQALYLEVVPVIGINQEVNLTAVLLPLNP
NLTVFYWWIGHSLQPLLSLDNSVTTRFSDAGDVRVTVQAACGNSVLQDSRVLRVLDQFQV
MPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLL
PPPRPTRKRSLSNDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGGGGGYW
AVVVLFVIGLFAAGAFILYKRECRKRPGRTVYAQMHNEKEQEMTSPVSHSEDVQGAVQGE
EFIDDDLDSQTLGNHSGVVLSINSREMHSYLVS
Download sequence
Identical sequences ENSNLEP00000014390 ENSNLEP00000014390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]