SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014427 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014427
Domain Number 1 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-36
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-34
Family Netrin-like domain (NTR/C345C module) 0.000000383
Further Details:      
 
Domain Number 3 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014427   Gene: ENSNLEG00000011817   Transcript: ENSNLET00000015144
Sequence length 448
Comment pep:known_by_projection supercontig:Nleu1.0:GL397427.1:2603161:2609311:1 gene:ENSNLEG00000011817 transcript:ENSNLET00000015144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAATASLLGPLLTAWALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPN
KECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPL
VAPGNQVTLRMTADEGTGGRGFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDY
PPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAV
PGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPSPKPGTEPKVKLPPKS
QPLEKKEETPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLTVTVSL
IGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVENRGPVLPPESFVVLH
RPNQDQILTNLSKRKCPSQPVRAAESQD
Download sequence
Identical sequences G1RMG3
ENSNLEP00000014427 ENSNLEP00000014427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]