SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014432 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014432
Domain Number 1 Region: 97-193
Classification Level Classification E-value
Superfamily Immunoglobulin 8.99e-26
Family I set domains 0.003
Further Details:      
 
Domain Number 2 Region: 180-285
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-24
Family I set domains 0.028
Further Details:      
 
Domain Number 3 Region: 11-105
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 293-383
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-22
Family I set domains 0.024
Further Details:      
 
Domain Number 5 Region: 403-503
Classification Level Classification E-value
Superfamily Fibronectin type III 8.08e-22
Family Fibronectin type III 0.000025
Further Details:      
 
Domain Number 6 Region: 528-713
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-20
Family Fibronectin type III 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014432   Gene: ENSNLEG00000011861   Transcript: ENSNLET00000015150
Sequence length 1494
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:11599848:11754337:1 gene:ENSNLEG00000011861 transcript:ENSNLET00000015150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLVSTVLRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIR
GGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEF
KCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEA
SATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQS
SSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGP
VNQTVAVDGTLVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTG
RYTCIASTPSGEATWSAYIEVQGKLNEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTV
TLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETFAIKGLKPNAIYLFLVRAA
NAYGISDPSQISDPVKTQDVPPTSQGVDHKQVQRELGNVVLHLHNPTILSSSSIEVHWTV
DQQSQYIQGYKILYRPSGANHGESDWLVFEVRTPTKNSVVIPDLRKGVNYEIKARPFFNE
FQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWC
LGNETRYHINKTVDGSTFSVVIPFLVXXXXXXXXXAASTGAGPGVKSEPQFIQLDSHGNP
VSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSVWLYRHRKKRNGLTSTYAGIRK
VPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPATQPWLADTWPNTGNSHNDCSINCCTA
GNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPN
LKDGRFVNPSGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQHNIM
EQNKLNKDYRANDPVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQ
GGMNWADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDER
GPTPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPERRRQPVS
PPPPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPAS
SVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLK
VARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAIMQKTRPAKKPKHQPGHLRRETYT
DDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSIDARTDRSSDRKGSSYKGREVLDG
RQVADMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNN
PRDPSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES
Download sequence
Identical sequences ENSNLEP00000014432 ENSNLEP00000014432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]