SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014443 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014443
Domain Number 1 Region: 458-643
Classification Level Classification E-value
Superfamily Fibronectin type III 5.33e-31
Family Fibronectin type III 0.00000692
Further Details:      
 
Domain Number 2 Region: 120-221
Classification Level Classification E-value
Superfamily Immunoglobulin 4.8e-24
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 328-432
Classification Level Classification E-value
Superfamily Fibronectin type III 7.76e-24
Family Fibronectin type III 0.000000955
Further Details:      
 
Domain Number 4 Region: 37-132
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-23
Family I set domains 0.0052
Further Details:      
 
Domain Number 5 Region: 229-319
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-23
Family I set domains 0.0073
Further Details:      
 
Domain Number 6 Region: 2-43
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000529
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014443   Gene: ENSNLEG00000011888   Transcript: ENSNLET00000015162
Sequence length 996
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:12730853:12884885:-1 gene:ENSNLEG00000011888 transcript:ENSNLET00000015162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQV
QGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGKMEASATL
TVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRC
SVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQT
LAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTC
VATSSSGETSWSAVLDVTESGATISKNYDLNDLPGPPSKPQVTDVTKNSVTLSWQPGTPG
TLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSP
MSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGY
RVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKT
VRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCLGNETRFHI
NKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVVITENSNSI
TEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMSNG
SRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATML
SDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKT
DLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNSTWANVPLPPPPVQPLPGTELEH
YAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASSPAISFGQQS
TATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTW
Download sequence
Identical sequences ENSNLEP00000014443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]