SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014455 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014455
Domain Number 1 Region: 400-501
Classification Level Classification E-value
Superfamily Immunoglobulin 5.81e-22
Family C2 set domains 0.0000451
Further Details:      
 
Domain Number 2 Region: 112-206
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-21
Family C2 set domains 0.00000352
Further Details:      
 
Domain Number 3 Region: 225-310
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-17
Family I set domains 0.027
Further Details:      
 
Domain Number 4 Region: 502-598
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-16
Family I set domains 0.076
Further Details:      
 
Domain Number 5 Region: 31-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000047
Family I set domains 0.0000119
Further Details:      
 
Domain Number 6 Region: 309-404
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000168
Family I set domains 0.00016
Further Details:      
 
Domain Number 7 Region: 592-686
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000295
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014455   Gene: ENSNLEG00000011881   Transcript: ENSNLET00000015174
Sequence length 739
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:33177345:33199307:1 gene:ENSNLEG00000011881 transcript:ENSNLET00000015174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKMAVIFGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHFSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLRIDGMDSVPAERQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPPPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYMCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGDLIGGSP
VTVSCKVPSVYPLDRLEIELLKGETILKNIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTILVSPSSILGEGSSVNMTCLSHGFP
APKILWSKQLPNGKLQPFSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIQKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENKKDYFSPGLLGLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
Download sequence
Identical sequences G1RMJ1
ENSNLEP00000014455 XP_003260166.1.23891 ENSNLEP00000014455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]