SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014468 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014468
Domain Number 1 Region: 143-343
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.35e-43
Family Prokaryotic proteases 0.00000129
Further Details:      
 
Domain Number 2 Region: 354-449
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-18
Family HtrA-like serine proteases 0.002
Further Details:      
 
Domain Number 3 Region: 24-94
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000675
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 4 Region: 80-126
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000108
Family Ovomucoid domain III-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014468   Gene: ENSNLEG00000011913   Transcript: ENSNLET00000015187
Sequence length 452
Comment pep:known_by_projection supercontig:Nleu1.0:GL397438.1:2140118:2176870:1 gene:ENSNLEG00000011913 transcript:ENSNLET00000015187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQARALLLAALVALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGE
PCGGPLDSPCGESLECVRGLCRCRWTHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQ
LQKGACPLGLHQLSSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIM
SEGLIITNAHVVSSKSAAPGRQQLKLQNGTGSRMSEFLAGLQGPADLSPSNASVWKKLPV
LLLGQSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQREGRELGLRDSDMDYIQTDAIIN
YGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITQFLTEFQDKQIKDWKKRFIGIRM
RTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSE
LQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM
Download sequence
Identical sequences ENSNLEP00000014468 ENSNLEP00000014468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]