SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014491 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014491
Domain Number 1 Region: 267-359
Classification Level Classification E-value
Superfamily Immunoglobulin 4.33e-26
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 433-533
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-24
Family I set domains 0.0048
Further Details:      
 
Domain Number 3 Region: 945-1040
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-23
Family I set domains 0.0014
Further Details:      
 
Domain Number 4 Region: 1070-1165
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-22
Family I set domains 0.0064
Further Details:      
 
Domain Number 5 Region: 1169-1264
Classification Level Classification E-value
Superfamily Immunoglobulin 7.07e-22
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014491   Gene: ENSNLEG00000011872   Transcript: ENSNLET00000015211
Sequence length 1320
Comment pep:known_by_projection supercontig:Nleu1.0:GL397273.1:2345605:2454123:-1 gene:ENSNLEG00000011872 transcript:ENSNLET00000015211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDDSIEASTSISQLLRESYLAETRHRGNNERSRAEPSSNPFHFGSPSGAAEGGGGQDDL
PDLSAFLSQEELDESVNLARLAINHDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQD
NPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSSKRIRPRACKN
HKSKLESQNKVIQENSSSFSDLSERRERSSVPIPIPADTRDNEVNHALEQQEAKRREEEQ
AASEAAGGDTTPGSSPSSLYYEEPLGQPPRFTQKLRSREVPEGTRVQLDCIVVGIPPPQV
RWYCEGKELENSPDIHIVQAGNLHSLTIAEAFEEDTGRYSCFASNIYGTDSTSAEIYIEG
VSSSDSEGDPNKEEMNRIQKPNEVSSPPTTSAAIPPAVPQAQHLVAQPRVATIQQCQSPT
NYLQGLDGKPIIAAPVFTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYREGTLIEDSPD
FRILQKKPRSMAEPEEICTLVIAEVFAEDSGCFTCTASNKYGTVSSIAQLHVRGNEDLSN
NGSLHSANSTTNLAAIEPQPSPTHSEPLSVEQPPKPKLEGVLVNHNEPRSSSRIGLRVHF
NLPEDDKGSEASSEAGVVTTRQTRPDSFQERFNGQATKTPEPSSPVKEPPPVLAKPKLDS
TQLQQLHNQVLLEQHQLQNPSPSSPKEFPFNMSVLNSTAPLAVTTSSKQVKAPSSQTFSL
ARPKHFFPSTNTTAATVAPSSSPVFTLGSTPQTIQRTVSKESLLVSHPSVQTKSPGGLSI
QNEPLPPGPTEPTPPPFTFSIPSGNQFQPRCVSPTPVSPTSRIQNPVAFLSSVLPSLPAI
PPTNAMGLPRSAPSMPSQGLVKKNTKSPQPVNDDNIRETKNAVIRDLGKKITFSDVRPNQ
QEYKISSFEQRLMNEIEFRLERTPVDESDDEIQHDEIPTGKCIAPIFDKRLKHFRVTEGS
PVTFTCKIVGIPVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTGDDDGNYTIM
AANPQGRISCSGHLMVQSLPIRSRLTSAGQSHRGRSRVQERDKEPLQERFFRPHFLQAPG
DMVAHEGRLCRLDCKVSGLPPPELMWLLNGQPVLPDASHKMLVRETGVHSLLIDPLTQRD
AGTYTCIATNKTGQNSFSLELSVVAKEVKKAPVILEKLQNCGVPEGHPVRLECRVIGMPP
PVFYWKKDNETIPFTRERISMHQDTTGYACLLIQPAKKSDAGWYTLSAKNEAGIVSCTAR
LDIYAQWHHQIPPPMSVRPSGSRYGSLTSKGLDIFSAFSSMESTMVYSCSSRSVVESDEL
Download sequence
Identical sequences XP_003258257.1.23891 XP_012352453.1.23891 ENSNLEP00000014491 ENSNLEP00000014491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]