SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014518 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014518
Domain Number 1 Region: 65-442
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.88e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000236
Further Details:      
 
Domain Number 2 Region: 408-521
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7.9e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014518   Gene: ENSNLEG00000011936   Transcript: ENSNLET00000015239
Sequence length 522
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:929809:980320:-1 gene:ENSNLEG00000011936 transcript:ENSNLET00000015239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSAGAGQSWRRAARAYRGFPLLLPEPAALTRTLSRAMACRQEPQPQGPPPAAD
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFTSCEGKFDWRVIKEKRDAYVSRLNTIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGVPSTPHESEIPGASLGITSDGFFQLEELPSRSVIVGAG
YIAVEIAGILSALGSKTSLLIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVTEVKK
TLSGLEVSMVTAVPGRLPVMTVIPDVDCLLWAIGRDPNSKGLSLDKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGKENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQ
GLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences G1RMQ4
ENSNLEP00000014518 ENSNLEP00000014518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]