SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014540 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014540
Domain Number 1 Region: 1696-1998
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000301
Further Details:      
 
Domain Number 2 Region: 37-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-75
Family Carbonic anhydrase 0.00000762
Further Details:      
 
Domain Number 3 Region: 2011-2285
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.87e-72
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000143
Further Details:      
 
Domain Number 4 Region: 309-408
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000107
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014540   Gene: ENSNLEG00000011934   Transcript: ENSNLET00000015265
Sequence length 2315
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:12423083:12629605:1 gene:ENSNLEG00000011934 transcript:ENSNLET00000015265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILKRFLAYIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMV
FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALS
ILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPC
TDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTK
HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTENPELDLFPE
LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTN
RSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLND
GSKTVLRSPHMNLSGTAESLNTISITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFIS
ENISQGYIFSSENPETITYDVLIPESARNASEDSTSSGSEESLKDPSVEGNVWFPSSTDV
TAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMSQGPSVTDLEMPHYSTFAFFP
TEVTPHAFTPSSRQQDLVSTVNVVHSQTTQPVYNGETPLQPSYSSEVFPLVTPLLLDNQI
LNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ
ILPQVTSASESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLY
KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQG
SLFSGPSHIPIPKSSLITPTASLLQPTHALSGDGEWSGASSDSELLLPDTDGLTALNISS
PVSVAEFTYTTSVFGDDNKELSKSEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK
LNASLQETSVSISSTKGMFPGSLAHTTTKVFDHEISQVPENNFSVQPTHIVSQASGDTSL
KPVLSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASDVDTLLKTVLP
AVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL
TISYASEKYEPVLFKSESSHQVIPSLYSNDELFQTANLEINQAHPPKGRHAFATPVLSIE
EPLNTLINKFIHSDEILTSTKSSVTDKVFAGIPTVASDTFVSTDHSIPIGNGHVAITAVS
PNRDGSVTSTKLLFPSKATSELSHSAKSDADLVGGGEDGDTDDDDGDDDDDRDSDGLSIH
KCMSCSSYRESQEKVMNDSDTHENSLMDQNNPISYSLSENSEEDNRVTSVSSDSQTGMDR
SPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDSLN
ENETSTDFSFADANEKDADGILAAGDSEITPGFPQSPTPSVTSENSEVFHVSEAEASNSS
HESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR
VISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLGI
TADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAA
QGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQ
VLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAY
AKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEE
QYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPTGKTKLEKQFQLLSQSNIQQSDY
STALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL
HTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLS
NEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMI
VHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVIL
SLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV
Download sequence
Identical sequences G1RMS6
XP_003261303.1.23891 ENSNLEP00000014540 ENSNLEP00000014540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]