SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014557 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014557
Domain Number 1 Region: 372-495
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-27
Family Cadherin 0.0032
Further Details:      
 
Domain Number 2 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.00046
Further Details:      
 
Domain Number 3 Region: 261-356
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 82-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000514
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014557   Gene: ENSNLEG00000011961   Transcript: ENSNLET00000015282
Sequence length 790
Comment pep:known_by_projection supercontig:Nleu1.0:GL397290.1:18522709:18890907:-1 gene:ENSNLEG00000011961 transcript:ENSNLET00000015282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTSTSCICPVLVCLCFVQRCYGTAHHSSIKVTRNQTKHIEGETEVHHRPKRGWVWNQF
FVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQ
KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMGTSVLQ
VTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKD
MAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSN
ADMTYSIINGDGMGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSH
LGPFKDATMLKIIVGDVDEPPLFSMPSYVMEVYENAKIGTVVGTVLAQDPDSTNSLVRYF
INYNVEDDRFFNIDANTGTIKTTKVLDREETPWYNITVTASEIDNPDLLSHVTVGIRVLD
VNDNPPELAREYDIVVCENSKPGQVIHTISATDKDDFANGPRFNFFLDEHLPVNPNFTLK
DNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTC
HAEAFLSSAGLSTGALIAILLCVLILLAIVVLFITLRRSKKEPLIISEEDVRENVVTYDD
EGGGEEDTEAFDIIALRNPSAAEELKYRRDIRPEVKLTPRHQTLSTLESIDVQEFIKQRL
AEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDWGPEFKKLAEL
YGEIESERTT
Download sequence
Identical sequences G1RMU3
ENSNLEP00000014557 ENSNLEP00000014557 XP_003263228.1.23891 XP_012357178.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]