SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014559 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014559
Domain Number 1 Region: 196-318
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 4-94
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-17
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 87-201
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 305-413
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000528
Family Cadherin 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014559
Domain Number - Region: 402-472
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0375
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014559   Gene: ENSNLEG00000011990   Transcript: ENSNLET00000015284
Sequence length 617
Comment pep:known_by_projection supercontig:Nleu1.0:GL397290.1:20535178:20669869:-1 gene:ENSNLEG00000011990 transcript:ENSNLET00000015284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAYVLQVKATDADDPTYGNSARVVYSILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQV
LIQAKDMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPIGSAIGRIRAVD
PDFGQNAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKVYRQMFGQLTTXXXXLKLQCG
GIHSAGPFKDTATVKISVLDVDEPPVFSRPLYTMEVYEDTPVGTIIGAVTAQDLDVGSSA
VRYFIDWKSDGDSYFTIDGNEGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNILI
NVLDVNEFPPEISVPYETAVCENAKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPN
FTVRDFRNNTAGIETRRNGYSRRQQELYFLPVIIEDSSYPVQSSTNTMTIRVCRCDSDGT
ILSCNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKDTLMTSKEDIRDNV
IHYDDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCLPRQRPPVEDNTDIRDFI
HQRLQENDVDPTAPPYDSLATYAYEGSGSVAESLSSIDSLTTEADQDYDYLTDWGPRFKV
LADMFGEEESYNPDKVT
Download sequence
Identical sequences ENSNLEP00000014559 ENSNLEP00000014559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]