SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014571 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014571
Domain Number 1 Region: 705-808
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-23
Family Cadherin 0.0042
Further Details:      
 
Domain Number 2 Region: 610-717
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 807-920
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 497-613
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 141-257
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 6 Region: 920-1027
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 1132-1249
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-16
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 1032-1144
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000134
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 389-509
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000428
Family Cadherin 0.0061
Further Details:      
 
Domain Number 10 Region: 289-387
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000123
Family Cadherin 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014571
Domain Number - Region: 80-147
Classification Level Classification E-value
Superfamily Cadherin-like 0.0811
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014571   Gene: ENSNLEG00000011914   Transcript: ENSNLET00000015297
Sequence length 1539
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:16421184:17405468:1 gene:ENSNLEG00000011914 transcript:ENSNLET00000015297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRQFYLRTCLASGIILGSLFEICLGQYDDDCKLARGGPPATIVAIDEESRNGTILVDNM
LIKGTAGGPDPTIELSLKDNVDYWVLMDPVKQMLFLNSTGRVLDRDPPMNIHSIVVQVQC
INKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPVGTTIFTGFSGDNGATDID
DGPNGQIEYVIQYNSDDPTSNDTFEIPLMLTGNIVLRKRLNYEDKTRYFVIIQANDRAQN
LNERRTTTTTLTVDVLDGDDLGPVFLPCVLVPNTRDCRPLTYQAAIPELRTPEELNPIIV
TPPIQAIDQDRNIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELSLLEPVNRDFHQK
FDLVIKAEQDNGHPLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGATISDSLNL
TSPLRIVALDKDIEDTKDPELHLFLNDYTSVFTVTQTGITRYLTLLQPVDREEQQTYTFS
ITAFDGVQESEPVIVNIQVMDANDNTPTFPEISYDVYVYTDMRPGDSVIQLTAVDADEGS
NGEITYEILVGAQGDFIINKTTGLITIAPGVEMIVGRTYALTVQAADNAPLAERRHSICT
VYIEVLPPNNQSPPRFPQLMYSLEISEAMRVGAVLLNLQATDREGDSVTYAIENGDPQRV
FNLSETTGILTLGKALDRESTDRYILIITASDGRPGGTSTATVNIVVTDVNDNAPVFDPY
LPRNLSVVEEEANAFVGQVKATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNRE
VRDYYELVVVATDGAVHPRHSTLTLAIKVLDIDDNSPVFTNSTYTVLVEENLPAGTTILQ
IEAKDVDLGANVSYRIRSPEVKHFFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFD
IYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGLPA
SRVRYRIDDVQFPYPASIFDVEEDSGRVITRVNLNEEPTTIFKLVVVAFDDGEPVMSSSA
TVKILVLHPGEIPRFTQEEYRPPPVSELATKGTMVGVISAAAVNQSIVYSIVSGNEEDTF
GINNITGIIYVNGPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENNH
PPVFQKKFYIGGVSEDARMFTSVLRVKATDKDTGNYSVMAYRLIIPPIKEGKEGFVVETY
TGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLV
EKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAFSLEDYTKCDLTVYAIDPQTNRA
IDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEGALLAL
AFIIILCCIPAILVVLVSYRQVKRQAECTKTARIQAALPAAKPAAPAPAPVAAPPPPPPP
PGAHLYEELGDSSILKNRNYPWSLELILARNMDKIITVMSMGMKCLNMGVAVDCYHQLDR
RNMGRWLVKLRKNMRRKRKSQRKLKNQKLKLESLVRRKK
Download sequence
Identical sequences ENSNLEP00000014571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]