SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014582 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014582
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 7e-26
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 262-377
Classification Level Classification E-value
Superfamily Cadherin-like 7e-25
Family Cadherin 0.00099
Further Details:      
 
Domain Number 3 Region: 373-491
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-23
Family Cadherin 0.0088
Further Details:      
 
Domain Number 4 Region: 482-587
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.003
Further Details:      
 
Domain Number 5 Region: 78-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014582   Gene: ENSNLEG00000012000   Transcript: ENSNLET00000015308
Sequence length 788
Comment pep:known_by_projection supercontig:Nleu1.0:GL397290.1:22984387:23140227:-1 gene:ENSNLEG00000012000 transcript:ENSNLET00000015308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIHQFLLLFLFWVCLPHFCSPEIMFRRTPVPQQRILSSRVPRSDGKILHRQKRGWMWNQ
FFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDRE
EKAFYTLRAQAINRRTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVV
QVTATDADDPSYGNSARVIYSILQGQPYFSVEPETGIIRTALPNMNRENREQYQVVIQAK
DMGGQMGGLSGTTTVNITLTDVNDNPPRFPQNTIHLRVLESSPVGTAIGSVKATDADTGK
NAEVEYRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRLYTLKVEAENTHVDPRFY
YLGPFKDTTIVKISIEDVDEPPVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRF
SLDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNPKETTRVAVFVRIL
DVNDNAPQFAVFYETFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDN
EDNTARILTRKNGFNRHEISTYLLPVVISDNDYPIQSSTGTLTIRVCACDSQGNMQSCSA
EALLLPAGLSTGALIAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDE
GGGEEDTQAFDIGTLRNPAAIEEKKLRRDIIPETLFIPRRTPTAPDNTDVRDFINERLKE
HDLDPTAPPYDSLATYAYEGNDSIAESLSSLESGTTEGDQNYDYLREWGPRFNKLAEMYG
GGESDKDS
Download sequence
Identical sequences G1RMW8
XP_003263231.1.23891 ENSNLEP00000014582 ENSNLEP00000014582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]