SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014583 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014583
Domain Number 1 Region: 133-246
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-33
Family C-type lectin domain 0.000000824
Further Details:      
 
Domain Number 2 Region: 107-130
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000000235
Family Triple coiled coil domain of C-type lectins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014583   Gene: ENSNLEG00000012005   Transcript: ENSNLET00000015309
Sequence length 247
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:18220837:18224660:1 gene:ENSNLEG00000012005 transcript:ENSNLET00000015309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLIPSLSLLLMSMVAASYSETVTCEDAQKTCPAVIACSSPGINGPGKDGRDGTKGEKGE
PGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGNSPDCDSSLAVSERKALQTEMAR
IKKWLTFSLGKQVGNKFFLTNGEMMTFEKVKALCVKFQASVATPRNAAENRAIQNLIKEE
AFMGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLRNGRWNDVPCSSSHL
AVCEFPI
Download sequence
Identical sequences G1RMW9
ENSNLEP00000014583 ENSNLEP00000014583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]