SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014615 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014615
Domain Number 1 Region: 147-266
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-26
Family Cadherin 0.00026
Further Details:      
 
Domain Number 2 Region: 372-492
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.0047
Further Details:      
 
Domain Number 3 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-22
Family Cadherin 0.00081
Further Details:      
 
Domain Number 4 Region: 482-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-16
Family Cadherin 0.0037
Further Details:      
 
Domain Number 5 Region: 76-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014615   Gene: ENSNLEG00000012011   Transcript: ENSNLET00000015341
Sequence length 789
Comment pep:known_by_projection supercontig:Nleu1.0:GL397290.1:25127053:25287991:-1 gene:ENSNLEG00000012011 transcript:ENSNLET00000015341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTYHCIPLFIWTYMLHIVDTILLQEKPNSYLSSKKIVGLTKDDGKMLRRTKRGWMWNQF
FLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREE
KSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQ
VTATDADDANYGNSAKVVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGEN
AEMEYSIAEGDGADMFDVITDKDTQEGIITVKQNLDFENQMLYTLRVDASNTHPDPRFLH
LGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS
VDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSHIPVFIRILD
INDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIV
DNKDNTAGIMTRKDGYSRNKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGHMQSC
TAEALILSAGLSTGALVAILLCVLILLILVVLFAALKRQRKKEPLIISKDDVRDNIVTYN
DEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVMPETIFQIRRTVPLWENIDVQDFIHRRL
KENDADPSAPPYDSLATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDWGPRFKKLADM
YGGDDSDRD
Download sequence
Identical sequences G1RN01
ENSNLEP00000014615 ENSNLEP00000014615 XP_003263232.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]