SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014708 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014708
Domain Number 1 Region: 33-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000542
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014708   Gene: ENSNLEG00000012112   Transcript: ENSNLET00000015446
Sequence length 241
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:6255536:6266918:1 gene:ENSNLEG00000012112 transcript:ENSNLET00000015446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVSRSNIARHLQTNLILYCVGAVGTCTVSVTQPWYLEVDYTHEAVTIKCNFSATGCPS
EQPTRLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGI
AFPSVPEARAKQTGGGTTLVVREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSK
SNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYER
P
Download sequence
Identical sequences G1RN94
ENSNLEP00000014708 XP_003261489.1.23891 ENSNLEP00000014708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]