SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014710 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014710
Domain Number 1 Region: 92-138
Classification Level Classification E-value
Superfamily RING/U-box 5.82e-20
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014710
Domain Number - Region: 20-62
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0403
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014710   Gene: ENSNLEG00000012113   Transcript: ENSNLET00000015448
Sequence length 155
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:3902960:3923431:-1 gene:ENSNLEG00000012113 transcript:ENSNLET00000015448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPFQWCNGCFCGLGLVSTNKSCSMPPINFQDLPLNIYMVIFGTGIFVFMLNLIFCCYFI
IKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCL
VKWLEVRCVCPMCNKPIAGPSEATQNIGILLDELV
Download sequence
Identical sequences G1RN96
ENSNLEP00000014710 ENSNLEP00000014710 XP_003269613.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]