SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014711 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014711
Domain Number 1 Region: 43-238
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 4.32e-77
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000107
Further Details:      
 
Domain Number 2 Region: 319-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 1.83e-65
Family C-terminal domain of adenylylcyclase associated protein 0.0000000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014711   Gene: ENSNLEG00000012077   Transcript: ENSNLET00000015449
Sequence length 475
Comment pep:known_by_projection supercontig:Nleu1.0:GL397355.1:4863965:4895188:1 gene:ENSNLEG00000012077 transcript:ENSNLET00000015449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYGDSPSKAGAAPYVQAFDSLLAGPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPADNKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP
PVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKTHKNPALNAQSDPVRSGPKPF
SAPKPQTSPSPKPATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTT
LQIKGKINSITVDDCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences G1RN97
ENSNLEP00000014711 ENSNLEP00000014711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]