SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014726 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014726
Domain Number 1 Region: 850-928
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 161-252
Classification Level Classification E-value
Superfamily Immunoglobulin 6.37e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 251-301
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000562
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 307-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000876
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 54-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000276
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014726   Gene: ENSNLEG00000012128   Transcript: ENSNLET00000015464
Sequence length 953
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:5569661:6135806:1 gene:ENSNLEG00000012128 transcript:ENSNLET00000015464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAAATGGGGGGARRWLPWLGICFSSLLEAMWPGTDNGEALPESIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWEVWSEWSVCSPECEHMRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKTPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAF
QEVVSDESHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWC
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences ENSNLEP00000014726 ENSNLEP00000014726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]