SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014749 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014749
Domain Number 1 Region: 110-441
Classification Level Classification E-value
Superfamily Subtilisin-like 7.46e-98
Family Subtilases 0.00000000000491
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-42
Family Proprotein convertase P-domain 0.000000379
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.46e-24
Family Prohormone convertase 1 pro-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 583-649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014749   Gene: ENSNLEG00000012144   Transcript: ENSNLET00000015491
Sequence length 706
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:8228833:8236871:1 gene:ENSNLEG00000012144 transcript:ENSNLET00000015491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRPWLLWVVAATGTLVLLAAHAQGHRVFTNTWAVRIPGGPTVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKEAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSPSAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
IIRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXPAAPGRGGGAAAAGRAAALTPA
Download sequence
Identical sequences ENSNLEP00000014749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]