SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014758 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014758
Domain Number 1 Region: 28-109
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-26
Family I set domains 0.0000298
Further Details:      
 
Domain Number 2 Region: 212-308
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-24
Family I set domains 0.00000979
Further Details:      
 
Domain Number 3 Region: 109-195
Classification Level Classification E-value
Superfamily Immunoglobulin 8.04e-22
Family C2 set domains 0.00000485
Further Details:      
 
Domain Number 4 Region: 391-478
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000388
Family I set domains 0.0000141
Further Details:      
 
Domain Number 5 Region: 309-391
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000123
Family C2 set domains 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014758   Gene: ENSNLEG00000012158   Transcript: ENSNLET00000015500
Sequence length 531
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:1594134:1609958:1 gene:ENSNLEG00000012158 transcript:ENSNLET00000015500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSGPWPALPALLVLLRALFPGLGNAETSVSPTKVILPRGGSVVVKCSTSCDQHTLLGI
ETPLPKKELLPGGNNWKMYELSNVQEDSQPMCYSNCGDRQSTAKTFLTVYWTPELVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEEELSRQPAVGEPTEVTATVLVSRDDH
GANFSCRTELDLRPQAELFKNTSAPHQLQTFVLPATPPQLVSPQVLEVDTQGTVVCSLDG
LFPVSEAQVYLALGDQRLDPTVTYGVDSLSAKASVSVTAEEEGTQQLLCAVILGNQSQET
RQTVTIYSFPAPNVTLTEPEVSEGTEVIVKCEAHPRAKVTLNGVPAQPPGPTAQFLLKAT
PEDNGRSFSCSATLEVAGQLVHKNQNQELRVLYGPRLDERDCPGNWTWPENSQQTPVCQA
WGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTRGEVTREVTVNVLSPRYGI
VIITVVAAAAILGTAGLTTYFYNRQRKIRKYRLQQAQKGTPMKPNTQATPP
Download sequence
Identical sequences G1RNE4
XP_012364955.1.23891 ENSNLEP00000014758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]