SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014789 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014789
Domain Number 1 Region: 47-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2e-121
Family Bee venom hyaluronidase 0.0000189
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000014789
Domain Number - Region: 429-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0136
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014789   Gene: ENSNLEG00000012182   Transcript: ENSNLET00000015533
Sequence length 481
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:14411543:14440719:1 gene:ENSNLEG00000012182 transcript:ENSNLET00000015533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLSEGHLRLCVVQPVHLTSWLLIFFILKSISCLKPAQLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDIDYYIPSEDFSGLAVIDWEYWRPQWARNWNAKDVYRQKSRKLISDMGRNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYTGSCPEE
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTSSKANCTKVKQFVSS
DLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPSSLMTLYLLLLASYQSIQ
L
Download sequence
Identical sequences G1RNH5
ENSNLEP00000014789 ENSNLEP00000014789 XP_003261316.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]