SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014907 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000014907
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 802-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 276-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Laminin-type module 0.064
Further Details:      
 
Domain Number - Region: 755-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0703
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 716-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014907   Gene: ENSNLEG00000012271   Transcript: ENSNLET00000015652
Sequence length 1140
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:26407862:26650524:1 gene:ENSNLEG00000012271 transcript:ENSNLET00000015652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVISLNSCLSFICLLLCHWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGFYESGEMCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCHCSP
GYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLY
GIKCDKQCPCHLDNTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVTGKCTCAPGFKGIDCSTPCPLGTYGINCSSRCGCKNDAVCSPVDGSCTCLAGWHGV
DCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCEQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMR
VINADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTATKSKNNQLFV
NLKNVNPGKRGPVGDCTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSN
CSLSSSENPYATIKDPPVLIPKSSECGYVEMKSPARRDSPYAEINNSTSANKNVYEVEPT
VSVVQGVFSNNGHLSQDPYDLPKNSHIPCHYDLLPVRDSSASPKQEDSGGSSSNSSSSSE
Download sequence
Identical sequences G1RNU3
ENSNLEP00000014907 ENSNLEP00000014907 XP_012360707.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]