SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014908 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014908
Domain Number 1 Region: 218-334
Classification Level Classification E-value
Superfamily DEATH domain 1.22e-37
Family DEATH domain, DD 0.000000903
Further Details:      
 
Domain Number 2 Region: 106-150
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000404
Family TNF receptor-like 0.0016
Further Details:      
 
Domain Number 3 Region: 48-101
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000765
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014908   Gene: ENSNLEG00000012260   Transcript: ENSNLET00000015653
Sequence length 335
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:22450166:22475230:1 gene:ENSNLEG00000012260 transcript:ENSNLET00000015653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGIWTLLPLVLTSVARLLSKSVNAQVTDINSKGLELRKTVTTIETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNEDEPDCVPCQEGKEYTDKVHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSAVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLWWFCLL
LFPILLTVWVMRKKIQKTCRKHRKENQGPHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKDAYDTLIKGLKK
ANLCTLAEKIQTIILKDITSDSENSNFGNEIQSLV
Download sequence
Identical sequences G1RNU4
ENSNLEP00000014908 XP_003255232.1.23891 ENSNLEP00000014908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]