SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014932 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014932
Domain Number 1 Region: 45-350
Classification Level Classification E-value
Superfamily L domain-like 5.71e-58
Family Ngr ectodomain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 352-441
Classification Level Classification E-value
Superfamily Immunoglobulin 5.43e-17
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014932   Gene: ENSNLEG00000012300   Transcript: ENSNLET00000015678
Sequence length 653
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:18590144:18594026:-1 gene:ENSNLEG00000012300 transcript:ENSNLET00000015678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLWQVTVHHHTWNAILLPVVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVV
CTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFN
GLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGE
LKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHG
LSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHN
PWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPR
DLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTS
TGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLA
AAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPT
IHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
Download sequence
Identical sequences A0A0D9SCQ8 F6Q3P7
ENSMMUP00000020242 NP_001253800.1.72884 XP_003261336.1.23891 XP_005550740.1.63531 XP_007981012.1.81039 XP_010377026.1.97406 XP_011727845.1.29376 XP_011851312.1.47321 XP_017751723.1.44346 ENSPANP00000009943 ENSNLEP00000014932 ENSNLEP00000014932 9544.ENSMMUP00000020242 ENSMMUP00000020242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]